<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
347965 347965 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDI 104
3 D4T+ 3TC+ SQV 144
4 D4T+ 3TC+ IDV 13
5 3TC+ ABC+ EFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S K20V, E35D, M36I, D60E, I62V, L63P, H69K, A71V  
>347965| codons 1-99
PQITLWQRPLVTIKIGGQLVEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
QVPIEICGKKVISTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215F K219Q G190S   V60I, K101Q, D123E, I135T, S162Y, V179I, E203D, R211K, L228H  
>347965| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIII
YQYVDDLYVSSDLEIGQHRTKIDELRQHLLKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVL

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005