<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1553 CA4440 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 108
2 3TC+AZT+IDV 21
3 D4T+RTV+SQV 52
4 D4T+DLV+NFV 21
5 3TC+D4T+NFV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75L, K219N L100I, K103N   K20R, E28K, K32E, V35L, T39K, K43E, E44D, V118I, K122E, Q197E, E203K, H208Y, R211K, K223Q, I293V, E297A  
>CA4440| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTKEKIEALLEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRTKIKELRQYLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L, G73S L10I, I13V, K20R, E35D, M36I, R41K, I62V, L63P, A71V, V77I  
>CA4439| codons 10-99
IVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGLIKVRQYDQVPIEICGH
KVISTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005