<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
272545 272545 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDI 52
3 AZT 169
4 AZT+ 3TC 13
5 AZT+ 3TC+ IDV 4
6 AZT+ 3TC+ RTV 13
7 AZT+ 3TC+ RTV+ SQV 25
8 D4T+ 3TC+ RTV+ SQV 82
9 DDI+ 3TC+ ABC+ EFV+ SQV+ NFV 12
10 DDI+ 3TC+ ABC+ EFV+ NFV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N K103N, G190S   E44D, V118I, K122E, V179I, G196E, T200A, I202V, E203V, Q207E, R211K, D250E  
>272545| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVSSDLEIEQHRAKVVELREHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M   L10V, K55R, R57K, D60E, Q61E, L63P, A71V, I72V, V77I  
>272545| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVRVKQYE
EIPIEICGHKVVGTVLIGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005