<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
266470 266470 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ RTV+ SQV 36
2 D4T+ 3TC+ NVP+ RTV+ SQV 58
3 D4T+ 3TC+ NVP+ NFV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, F53L, G73S L10I, N37D, L63P, A71V, V77I  
>266470| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVISTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V, V75I, K219R K101E, G190A   E28K, V35L, T39A, R83K, K122E K13N
>266470| codons 1-250
PISPIETVPVKLNPGMDGPKVKQWPLTKEKIKALLEICAEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005