Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| 249753 | 249753 | Spain | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDC | 28 |
| 2 | AZT+ DDC+ 3TC | 43 |
| 3 | D4T+ 3TC+ IDV | 20 |
| 4 | DDI+ D4T+ RTV+ SQV | 28 |
| 5 | DDI+ D4T+ SQV+ NFV | 59 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I15V, R41K, V82I, I93L |
| >249753| codons 1-99 PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD QILIEICGHKAIGTVLVGPTPINIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Tural, C | Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. | AIDS, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |