<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1552 CA4437 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV 22
3 D4T+DDI+NFV+SQV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I15V, E35D, M36I, R41K, Q61E, L63P, I93L  
>CA4437| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
EIPIEICGHKAIGTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, T215TNSY F116Y     V35I, I135T, I142T, D177E, Q207E, H208Y, R211K, T286A  
>CA4438| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSTNNETPGTRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001