<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
191730 191730 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 48
2 D4T+ 3TC 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98G R83K, K122E, D123N, I135V, Q174E, D177G, V189I, T200I, I202V  
>191730| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPGIVI
YQYVDDLYIGSDLEIGQHRIKVEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12Q, I15V, L63P  
>191730| codons 1-99
PQITLWQRPLVQIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005