<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
117405 117405 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+ DDC 144
3 AZT+ DDC+ SQV 94
4 DDI+ D4T+ RTV+ SQV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M V11I, F53L I13V, I15V, K20R, E35D, M36I, N37E, I62V, L63P, A71V, V77I, Q92K  
>117405| codons 1-99
PQITLWQRPLITVKVGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGLVKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F       K20R, I135L, Q174R, R211E, V245I  
>117405| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLEWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEK

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005