<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
110855 110855 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 105
2 AZT+ DDI 87
3 AZT+ DDI+ 3TC 69
4 AZT+ DDI+ 3TC+ RTV 19
5 D4T+ 3TC+ RTV 47
6 D4T+ 3TC+ RTV+ SQV 55
7 ABC+ EFV+ RTV+ SQV+ NFV 1
8 3TC+ EFV+ RTV+ SQV+ NFV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V T215V, K219Q K103N V108I K20R, V60I, V90I, I135T, S162Y, I195T, G196K, Q197L, Q207E, L228H  
>110855| codons 1-250
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLETKLHRTKIEELREHLLRWGFVTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V, L90M L33F, K43T, F53L I13V, E35D, M36L, N37T, R57K, D60E, L63P, A71V, V77I  
>110855| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEDLTLPGRWTPKMIGGIGGLVKVKQYE
QIPIEICGHKVIGTVLIGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005