<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
97280 97280 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 258
2 DDI+ D4T 143

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     K20R, T39A, V60I, K64Y, V106I, D123E, I135T, I178M, D218E, L228H N136S
>97280| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIYKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSTSNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, E35D, N37S, R41K, L63P  
>97280| codons 1-99
PQITLWQRPLVSIKVGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005