<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
57699 57699 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ NVP 25
2 None 4
3 AZT+ 3TC+ IDV 3
4 3TC+ NVP+ IDV 27
5 3TC+ NVP+ NFV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   R83K, E169D, D177E, I178V, T200E, E204K, R211K, F214L, V245E, E248D  
>57699| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEVVI
YQYVDDLYVASDLEIGQHREKIEKLRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I62V, L63S, A71V, V77I, I93L  
>57699| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVSIEICGHKVIGTVLIGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005