<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
50331 50331 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 79
2 AZT+ DDC+ 3TC 7
3 D4T+ 3TC+ IDV 95
4 DDI+ D4T+ NVP 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y V106M, G190A F227L E42K, S68N, V118I, K122E, R125G, I135T, K166R, K173E, F214L F124S
>50331| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMKKEGKISKIGPENPYNTPV
FAIKRKDNTRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYYSIPL
DEDSGKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFREQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I15V, G16E, P39T, I64V  
>50331| codons 1-99
PQITLWQRPVVIIKVEGQLKEALLDTGADDTVLEEMNLTGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005