<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
20619 20619 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 3
2 AZT+ DDC 35
3 AZT+ 3TC 87
4 D4T+ 3TC+ IDV 21
5 DDI+ D4T+ RTV+ SQV 39
6 NVP+ RTV+ NFV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W T215D Y188L   K22R, K49R, V90I, A98S, V118I, Q197P, E203K, R211K, K223E G15R, R143K
>20619| codons 1-250
PISPIETVPVKLKPRMDGPKVRQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIKYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGPHRTKIKELRQHLWKWGFDTPDKKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, K43T, T74P L10I, E35D, M36I, N37D, L63P, A71V, I93L  
>20619| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDIDLPGRWTPKIIGGIGGFVKVRQYD
QIPIEICGHKVIGPVLVGPTPTNVIGRNLLTQLGCTLNF

References
Author Title Citation
Tural, C Clinical utility of HIV-1 genotyping and expert advice: the Havana trial. AIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005