<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NILUTPM095 NILUTPM095 Nigeria 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, M50I, K71Q, L101I, T112V, S119R, T124S, T125A, K136T, E157Q, K160Q, V201I, T206S, K215N, Q216K, T218I, K219Q, L234I, N254D, D256E, D279G G134K, S283G
>NILUTPM095| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGQIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGRN
FTSSAVKAACWWAKITQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQNKIIQIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDDSEIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

References
Author Title Citation
Inzaule, SC Primary resistance to integrase strand transfer inhibitors in patients infected with diverse HIV-1 subtypes in sub-Saharan Africa. J Antimicrob Chemother, 2018