<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
UK4700 UK4700 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ EFV+ DDI 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101KE, V106M, G190S   V35T, T39E, V60VI, W88C, K122E, D123N, I135T, E138A, K173AT, Q174QK, T200A, E204EK, Q207QK, R211K, F214L, H221HY  
>UK4700| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVI
YQYVDDLYVSSDLEIGQHRAKIEKLRKHLLKWGLTTPDKKYQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  K43KT I15V, L19I, E35ED, M36I, D60E, Q61E, L63P, H69K, L89M, I93L  
>UK4700| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGRWTPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005