<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1535 CA4398 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 104
2 AZT 39
3 3TC+AZT 39
4 3TC+D4T+NFV 43
5 DDC+DLV+RTV+SQV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV, L90M N88D L10I, I13V, I15V, L63P, I64V, A71V  
>CA4398| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181YC   V8VI, E44ED, I135T, S162A, R211RK, V245E, A272P, V276VI, K277R, L283LI, T286TA, E297A  
>CA4399| codons 1-300
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLIRGAKALTEVIPLTAEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005