<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1533 CA4394 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 26
2 AZT+DDI 65
3 D4T 39
4 3TC+D4T 61
5 3TC+D4T+RTV+SQV 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, I13V, I15V, N37E, L63P, I93IL  
>CA4394| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35K, T39X, K122E, I135T, S162C, E169D, R211K, A272P  
>CA4395| codons 1-286
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICXELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001