<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1277 CA4391 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 D4T 30
3 DDI 68
4 AZT+ DDC 48
5 None 60
6 3TC+ AZT 7
7 3TC+ AZT+ IDV 8
8 3TC+ AZT+ NFV 56

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, K103R, K104KN, I135L, S162A, T200A, Q207E, F214L, D218DE, A272P, K277R, A288S  
>CA4391| codons 1-288
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23I K20KR, N37T, L63P, T74S, V77VI, V82I, I93L  
>CA4390| codons 1-99
PQITLWQRPLVTIKIGGQLREAILDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLIGPTPINIIGRNLLTQLGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012