<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1137 CA4388 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 None 31
3 DDC 135
4 D4T 22
5 D4T+DDI 17
6 3TC+D4T+SQV 26
7 3TC+AZT+IDV 26
8 3TC+AZT 22
9 3TC+AZT+RTV+SQV 32
10 3TC+AZT 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39TA, K43KQ, R83K, V90I, S162Y, A272P, K277R, Q278H  
>CA4388| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T   M36MI, G51GA, L63P, A71AV, I93IL  
>CA4387| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKIIGGIAGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005