<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1524 CA4366 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+DDI 13
3 None 122
4 3TC+AZT 35
5 3TC+D4T 78
6 3TC+D4T+SQV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y F77L   E138K V35T, T39A, K43KE, E44ED, V60I, K82R, V118I, K122E, I135T, H208HY, A272P, K277R, T286A, E297A  
>CA4366| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEEDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDLRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTAEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A   L10I, I13V, K14KR, M36I, N37D, L63P, A71AT, T74S  
>CA4365| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEIDLPGRWKPKMIVGIGGFIKVRQYD
QIPIEICGHKTIGSVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009