<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3897 CA4355 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 120
2 D4T+ IDV 17
3 3TC+ IDV 31
4 DLV+ NFV+ SQV 38
5 ABC+ D4T+ EFV+ RTV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R A62V, V75I K103N, Y181C   T39A, K49R, K102R, T107S, V111I, K122E, F214L, H221Y, A272P, K277R, T286A, V292I  
>CA4355| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPV
FVIKRKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVSVLDIGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L63P, A71V, V77I, I93L  
>CA4356| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005