<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F101329 F101329 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ AZT+ 3TC 169

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y   K103N   V35K, E36A, T39E, S48T, K122E, D123S, I135T, K173V, Q174K, D177E, I178M, T200A, Q207K, R211K, V245Q, A272P, E291ED, V292I, I293V, S322T, I326V  
>F101329| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKAICEELEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15IV, L19I, E35D, M36I, N37E, R41K, K45R, D60E, L63P, H69K, L89M, I93L  
>F101329| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDIELPGKWKPRMIGGIGGFIKVRQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005