<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F101714 F101714 U.K. 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ TDF+ NVP 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VI Y181YC   V35T, T39IM, V60I, K122E, D123GS, I135T, E138EG, K173S, Q174K, I178IL, V179I, Q207A, R211S, H221HY, V245E, D250E, S251SHNR, A272P, Q278H, T286A, V292I, I293V, E312D Y319Y*
>F101714| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDLII
CQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKERWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTEIVPLTEEAE
LELAENREILKDPVHGVY*DPSKDLIAEIQKQGQ

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005