<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F83557 F83557 U.K. 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 4
2 3TC+ AZT+ NFV 30
3 3TC+ ABC+ AZT 103

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F M36I, P39V, R41K, H69Q, L89M  
>F83557| codons 33-99
FEEINLVGKWKPKMIGGIGGFIKVRQYDQILIEICGQKAIGTVLVGPTPVNIIGRNMLTQ
IGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V K70KN     K20R, V35T, S68G, L100LV, D123DE, I135V, S162T, K166R, K173A, Q174E, D177E, I178M, T200A, Q207N, R211K, P243Q, V245Q, K277R, T286A, E291D, V292I, I293V, P294T, S322T, I326V D110DE
>F83557| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTNWRKLVDFRELNKRTQDFWEVQLGIPHPAGVKKKKSVTVLEVGDAFFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQTSMTRILEPFRAENPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQQIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005