<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M36208 M36208 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NFV 69
2 Unknown 17
3 NVP+ DDI+ D4T 146

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67N, K70R K219Q V106VM, Y181YC, G190A A98G E6EK, V8I, V35T, T39E, S48T, K122E, D123DN, K173A, D177E, T200A, E203K, Q207E, R211K, V245Q, S251SN, A272P, K277R, E291D, V292I, I293V  
>M36208| codons 1-333
PISPIKTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKRKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
CQYMDDLYVASDLEIGQHRAKIKELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDNWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36L, R41K, L63S, H69K, L89M, I93L  
>M36208| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005