<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M86744 M86744 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 RTV+ IDV+ 3TC+ AZT 13
2 EFV+ DDI+ AZT 187

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12PS, I13V, I15V, L19T, K20R, M36I, N37D, R41K, D60E, Q61E, H69K, I72IR, T74A, L89M, I93L  
>M86744| codons 1-99
PQITLWQRPLVSVKVGGQTREALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYE
EILIEICGKKARGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LV, L210W, T215Y   K103N, V106M   V35T, E36A, T39D, S48T, K122E, D123N, I135T, S162C, K173A, Q174K, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, E291D, V292I, I293V, D320DY, Q330QH  
>M86744| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDELEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYYPSKDLIAEIHKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005