<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M86254 M86254 U.K. 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 LPV+ 3TC+ AZT 8
2 NFV+ AZT+ 3TC 135

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20KR, V35T, V60I, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, F214FL, P243T, V245Q, A272P, T286A, E291ED, V292I, I293V, S322T, I326V  
>M86254| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88NS   L10LV, I13V, K14N, K20I, L33LV, M36I, N37ND, L63P, I66IF, H69K, K70KR, A71AT, T74TS, L89IM  
>M86254| codons 1-99
PQITLWQRPVVTVNIGGQLIEALLDTGADDTVVEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEFCGKRTIGSVLVGPTPVNIIGRSMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005