<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M83283 M83283 U.K. 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ AZT 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, E36D, T39A, E40ED, D86DE, F87FL, K101Q, K122P, S162A, K173T, Q174K, D177E, T200A, Q207E, P243S, V245Q, T286A, E291D, V292I, I293V, P294T, S322T M41MR
>M83283| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKDICADREKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQELWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15L, K20I, M36I, R41K, H69K, L89M  
>M83283| codons 1-99
PQITLWQRPLVTVKLGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005