<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F58125 F58125 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 D4T+ AZT+ 3TC 104
3 Unknown 104
4 NVP+ DDI+ D4T 52
5 TDF+ NVP+ DDI+ ABC 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   V106M, Y181C   K22KN, T27TP, V35T, E36A, T39E, S48T, K122E, D123G, T139I, S162C, K166R, K173A, D177E, T200A, Q207E, V245Q, E248EK, E291D, V292I, I293V, S322SA K13KN
>F58125| codons 1-333
PISPIETVPVKLNPGMDGPKVNQWPLPEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNEIPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRAQNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPKKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, T31TP, E35D, M36I, R41K, K43KN, R57RS, H69K, L89M, I93L L23LF
>F58125| codons 1-99
PQITLWQRPLVSIKVGGQIREAFLDTGADDPVLEDINLPGKWNPKMIGGIGGFIKVSQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005