<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F66883 F66883 U.K. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 95
2 D4T+ NVP+ DDI 167

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101KE, Y181C, G190A   D17DG, V35T, E36A, T39E, S48T, D123E, I135V, K173T, D177E, T200A, Q207E, L228R, V245Q, A272P, K277R, E291D, I293V, P321S  
>F66883| codons 1-334
PISPIETVPVKLKPGMGGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
CQYMDDLYVASDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDSSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, Q18QP, L19IT, L24LF, M36I, R41K, L63V, H69K, L89LM, I93L R8RP
>F66883| codons 1-99
PQITLWQPPLVSIKVGGPTKEALFDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005