<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M36781 M36781-2 U.K. 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP 8
2 Unknown 33
3 3TC+ EFV+ AZT 23
4 AZT+ 3TC+ NVP 31
5 None 17
6 NVP+ AZT+ 3TC 94
7 DDI+ LPV+ TDF 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F V75I K103N   V35T, V90I, A98S, K122E, D123N, I132L, I135T, S162H, K173A, D177E, T200A, Q207A, R211N, V245M, K281R, E291D, I293V, P294T, E298G, E312N, S322A  
>M36781-2| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLIDFRELNKRTQDFWEIQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTLPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLNWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDVVTLTEGAE
LELAENREILKNPVHGVYYDPAKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, E35D, M36I, R41K, K45R, R57K, H69K, I72K, L89M  
>M36781-2| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAKGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005