Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| RC-034-084-441 | 084-4411 | Portugal | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | ATV+AZT+3TC | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I50IL | G73GS | L10V, T12TS, K14KR, K20R, M36L, N37D, R41K, I62V, L63P, V77I, I93L |
| >084-4411| codons 1-99 PQITLWQRPVVSIRIGGQLREALLDTGADDTVLEELDLPGKWKPKMIGGLGGFIKVRQYD QVPIEICGHKAISTVLIGPTPVNIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Colonno, RJ | Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. | J Infect Dis, 2004 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |