<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-034-076-586 076-5861 South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 ATV+AZT+3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L   T12S, I15V, L19I, M36I, R41K, K45N, L63P, H69K, L89M, I93L  
>076-5861| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPNMIGGLGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004