<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-034-067-562 067-5621 South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 RTI+ ATV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L   K14R, I15V, L19I, K20T, E34EK, E35D, M36I, N37D, R41K, K55KN, D60E, I64IV, H69K, A71V, L89MT, I93L  
>067-5621| codons 1-99
PQITLWQRPLVTIRVGGQITEALLDTGADDTVLKDIDLPGKWKPKMIGGLGGFINVRQYE
QILVEICGKKVIGTVLVGPTPVNIIGRNTLTQLGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004