<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RC-007-023-496 023-4961 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ATV+D4T+DDI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L G73S K14R, I15V, E34A, E35D, N37D, I62IV, L63P, V77I  
>023-4961| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLADMDLPGRWKPKMIGGLGGFIKVRQYD
QVPIEICGHKAISTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Colonno, RJ Identification of I50L as the signature atazanavir (ATV)-resistance mutation in treatment-naive HIV-1-infected patients receiving ATV-containing regimens. J Infect Dis, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005