<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
in109 in109 India 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KR, I15V, L19I, M36L, N37A, Q61QH, L63P, H69K, L89M, I93L  
>in109| codons 1-99
PQITLWQRPLVSIRVGGQIKEALLDTGADDTVLEELALPGRWKPKMIGGIGGFIKVRQYD
HIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, V60I, D121Y, K122E, K173A, D177E, T200A, Q207QK, R211KQ  
>in109| codons 10-239
VKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPIFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYMDDLYV
GSDLEIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Deshpande, A Molecular characterization of HIV type 1 isolates from untreated patients of Mumbai (Bombay), India, and detection of rare resistance mutations. ARHR, 2004