<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C14-2069014 LC171040 Japan 2014 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, S39C, S57G, K71Q, E96A, L101I, S119T, T124S, A196AP, V201I, T206S, K211KR  
>LC171040| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVACCDKCQLKGEAMHGQVDCGPGI
WQLDCTHLEGQIILVAVHVASGYIEAEVIPAETGQATAYFILKLAGRWPVKTIHTDNGTN
FTSSTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSPGERIIDIIASDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L Q58QE R41K, I62IV, L63P, T74A  
>LC170781| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVREYD
QVPIEICGHKAIGAVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35I, S68G, S162C, E203D, Q207E, R211K  
>LC170781| codons 1-246
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVL

References
Author Title Citation
Hachiya, A Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: Nationwide surveillance from 2013 to 2015 in Japan. Unpublished, 2017