<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SR_Pat33 SR149695 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, V11I T4P, I13V, K20I, E35D, M36I, N37H, R41K, F53FY, D60DE, I62V, L63P, K70N, A71V, P79A, T91S, Q92K, N98I  
>SR149695| codons 1-99
PQIPLWQRPFITVKIGGQLIEALLDTGADDTVLEDIHLPGKWKPKIIGGIGGYVKVRQYE
QVPIEICGHNVIGTVLVGATPVNVIGRNLMSKIGCTLIF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K122E, I142V, E169D, T200A, Q207E, V245K, I293IV, E297V, D324E, Q334D  
>SR149695| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTVEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGDG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010