<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SR_Pat26 SR196077 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, V11I T4P, I13V, K20I, A22AV, E35D, M36I, N37H, R41K, D60E, I62V, L63P, A71V, I72IL, P79AD, T91S, Q92K  
>SR196077| codons 1-99
PQIPLWQRPFITVKIGGQLIEVLLDTGADDTVLEDIHLPGKWKPKIIGGIGGFVKVRQYE
QVPIEICGHKVLGTVLVGATPVNVIGRNLMSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103NS   K122E, I142V, E169D, T200A, Q207E, V245K, K277X, I293V, E297V, A304AE, D324E, Q330P, Q334D  
>SR196077| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVXQLCKLLRGTKALTEVVPLTVEAE
LELEENREILKEPVHGVYYDPSKELIAEIPKQGDG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006