<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1503 CA4303 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDC 104
3 NRTI 173
4 D4T 30
5 D4T+ DDI 26
6 SQV+ DDI+ D4T 26
7 IDV+ D4T+ 3TC 17
8 NVP+ D4T+ 3TC 4
9 NFV+ AZT+ 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, M184V, T215Y D67G     E36EQ, S68G, K102Q, K103R, K122E, I135V, S162C, G196E, I202IM  
>CA4303| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVQICTELEKEGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKMEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88ND N37NS, K45KR, L63A, V77I  
>CA4302| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMSLPGRWKPRMIGGIGGFIKVRQYD
QIAIEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005