<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
G14-801378 LC161283 Japan 2014 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V32I, S39SC, L45LI, L101V, K111KT, S119T, T124N, T125A, I135V, V201I, T206S, I217S, N222X, S230N  
>LC161283| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVIAKEIVACCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFVLKLAGRWPVTTIHTDNGTN
FTSNAVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQSTKIQXFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13V, K14KR, I62IV, L63P, I64V, V77VI  
>LC162965| codons 1-99
PQITLWQRPLVAVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, V35I, V60VI, K122KE, D123E, I135L, S162C, Q174QK, D177DE, V189VI, T200TI, Q207E  
>LC162965| codons 1-240
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPEIVI
YQYMDDLYIGSDLEIGQHRIKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hachiya, A Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: Nationwide surveillance from 2013 to 2015 in Japan. Unpublished, 2017