<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18429 CA43005 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 187
2 DDI+EFV 26
3 ABC+D4T+NFV 180

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10F T12P, K14R, I15V, G16E, K20T, R57RK, I62V, L63N, V77I  
>CA43005| codons 1-99
PQITLWQRPFVPIRVEGQLTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVNIEICGHKAIGTVLIGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, Y115F, M184V, T215F K219Q L100I, K103N   P4PS, M16V, K43E, T69N, I135L, S162A, V179VI, T200A, D218E, L228H, A288S, V292I, V317A, R356K, G359S, K366R  
>CA43006| codons 1-369
PISSIETVPVKLKPGVDGPKVKQWPLTEEKIKALVEICTEMEEEGKISKIGPENPYNTPV
FAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEIIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVRQLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005