<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C14-305147 LC161261 Japan 2014 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10A, E13ED, K14KR, N27G, P30A, S39C, I84M, E96ED, L101LI, S119T, T124N, T125A, I135V, G163T, V201I, T206S  
>LC161261| codons 1-288
FLDGIDKAQAEHDRYHSNWRAMASDFGLPAVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQDTAYFILKLAGRWPVKTIHTDNGTN
FTSNAVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIITQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, N37D, R57RK, I62V, L63T, A71V, I72IT, T74A, I93L  
>LC162943| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYD
QVTIEICGHKVTGAVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TI     E6D, K32N, V35I, S68G, D123E, I135R, S162C, I178L, T200TI, E203ED, Q207X, R211K  
>LC162943| codons 1-240
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKINALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRIKIDELRXHLLKWGFITPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hachiya, A Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: Nationwide surveillance from 2013 to 2015 in Japan. Unpublished, 2017