<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18424 CA42995 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 135
2 3TC+D4T+EFV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10I, E35D, R41K, I62V, L63P, A71T, V77I, I93L  
>CA42995| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108VI, P225PH K11R, K20R, T139K, S162C, F171Y, G196E, T200A, Q207N, R211K, K277R, T286A, I293V, K311R, P313Q, G333E, Q334L W252W*
>CA42996| codons 1-345
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPYRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRNHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDS*TVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILREQVHGVYYDPSKDLIAEIQKQELGQWTYQIYQEP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005