<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18408 CA42964 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 231

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I     E40ED, I135IV, K173KE, V241VI, V245K, K277R, I293V, T386TI, K390R, E399EG, A400T, N447S, S519N, K527N, V548VI, A554S, V559I  
>CA42964| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWGTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKEKVYLAWVPAHK
GIGGNEQIDKLVSSGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K70R, A71T, I72T, V77I, Q92R  
>CA42963| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHRTTGTVLIGPTPVNIIGRNLLTRIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005