<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18397 CA42942 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV+SQV 22
2 None 9
3 3TC+D4T+IDV 113
4 D4T+DDI+EFV 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184MV   K103N, Y181C   I31L, V118VI, I135T, K166KR, G196E, K201KR, Q207E, H221Y, P243S, V245K, A272P, T286A T240TM
>CA42942| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTRIEELREHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWM
VQSIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, L63P, I64V, I93L G68GR
>CA42941| codons 1-99
PQITLWQRPLVPIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICRHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005