<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18384 CA42916 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+NVP+TDF 52
3 3TC+EFV+TDF 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65KR, M184V, L210W, T215DY A62AV V106A, G190A F227FL E6EK, K20R, V35I, K122E, I135T, S162A, G196E, T200A, I202V, E203EQ, Q207E, R211K, K277R, I293V, T296S, E297K S68SDGN
>CA42916| codons 1-300
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FVIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRAKVQELREHLWKWGFYTPDKKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLSKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, T12D, L19I, M36I, N37S, R41K, I62V, L63P, A71V  
>CA42915| codons 1-99
PQITLWQRPIVDIKIGGQIKEALIDTGADDTVLEEISLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005