<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA18383 CA42913 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+IDV 375

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E L10I, E35G, M36I, I62V, L63A, I93L, C95F  
>CA42913| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVREYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K101E   K32N, V35T, K49KR, S68G, V118I, K122E, D123E, I135R, D177E, I178L, Q207E, R211K, K223KQ, V245K, E297T E203DN
>CA42914| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALTEICTELEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKINELREHLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTTEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005