<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C14-51111667 LC160924 Japan 2014 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24N, V31I, L45V, L101V, T125V, G163E, T206S, K215N, D256E, D278N  
>LC160924| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANDFNLPPIVAKEIVASCDKCQVKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFVLKLAGRWPVKTIHTDNGSN
FTSTVVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQNQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGNDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, R41K, Q61N, V77I, I93L  
>LC162223| codons 1-99
PQITLWQRPLVNIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
NILIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, K122E, D123E, I135T, S162C, E169D, K173Q, I178L, G196E, Q197K, T200A, Q207R, R211K  
>LC162223| codons 1-240
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRQQNPDLVI
YQYMDDLYVGSDLEIEKHRAKIEELRRHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Hachiya, A Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: Nationwide surveillance from 2013 to 2015 in Japan. Unpublished, 2017