Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA1499 | CA4282 | U.S. | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC | 44 |
| 2 | DDI | 126 |
| 3 | D4T | 52 |
| 4 | 3TC+D4T | 65 |
| 5 | 3TC+D4T+IDV | 58 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, L90M | G73S | N37C, I62V, L63P, A71V, V77I, I93L |
| >CA4282| codons 1-99 PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMCLPGRWKPKLIGGIGGFIKVRQYD QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. | AAC, 2002 |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Rhee, SY | Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. | J Infect Dis, 2009 |